Retatrutide vs Tirzepatide

The glucagon receptor. Tirzepatide activates GLP-1R and GIPR. Retatrutide activates those two plus GCGR, which adds thermogenesis and hepatic lipolysis to the pharmacology. Structurally both are 39-amino-acid fatty-acylated peptides of similar molecular weight.

No. Retatrutide is investigational, currently in Phase 3 trials, and is not approved by the FDA for any indication.

Yes. Approved drug products containing tirzepatide exist for type 2 diabetes and for obesity, under separate brand names. That approval covers the pharmaceutical product manufactured and reviewed under those applications. Research-market tirzepatide is not that product and carries none of that regulatory review.

No published trial has compared them directly, so there is no evidence-based answer. Retatrutide's reported figures come from a phase 2 trial; tirzepatide's come from completed phase 3 programmes. Comparing numbers generated at different trial phases, in different cohorts, over different durations is the single most common error made on this topic.

They are close and both support weekly dosing. Retatrutide's published phase 1 pharmacokinetics report approximately six days; tirzepatide's published pharmacokinetics report approximately five. Both figures come from the fatty-acid chain each molecule carries, which binds serum albumin and keeps the peptide out of renal clearance.

No published study has tested the combination, and there is no mechanistic rationale for it. Retatrutide already agonises both receptors tirzepatide targets, so adding tirzepatide duplicates GLP-1R and GIPR activity without introducing a new pathway — while making any observed effect impossible to attribute to either compound.

Tirzepatide, by a wide margin. It has completed phase 3 programmes across diabetes and obesity indications plus a growing post-approval literature. Retatrutide's human dataset is one published phase 2 trial and its phase 1 pharmacokinetics, with phase 3 still recruiting or ongoing.

That a single molecule activates three separate receptors — in retatrutide's case GLP-1R, GIPR and GCGR. Dual agonism, as in tirzepatide, means two. The count matters because each receptor contributes a different metabolic action, and the glucagon receptor pushes in the opposite direction to the other two.

Because GCGR activation also drives thermogenesis and lipolysis, and the simultaneous GLP-1R activation counterbalances the glycaemic effect. The combination is what makes the third receptor additive rather than counterproductive.

YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS — 39 residues, published by the IUPHAR/BPS Guide to Pharmacology as ligand 13769 (CAS 2381089-83-2, PubChem CID 171390338, InChIKey MLOLQJNKXBNWFW-SAGGEDDASA-N). Four positions are non-proteinogenic: aminoisobutyric acid at 2 and 20, alpha-methyl-leucine at 13, and a C20 fatty diacid on Lys17 through a gamma-glutamyl and AEEA linker, with a C-terminal amide. This page previously said the sequence was not disclosed and that any source publishing one was not citing a disclosed reference; both statements were wrong and are corrected here.

Yes. Both are verified at ≥99% purity by reverse-phase HPLC with LC-MS/MS molecular identity confirmation, and ship with a batch-specific Certificate of Analysis. All material is for in-vitro laboratory research use only.