Retatrutide
Retatrutide at a glance
Peptide.Express Retatrutide (CAS 2381089-83-2) starts at $65, ≥99% HPLC as the sourcing specification — not a measurement of any one vial — with a molecular weight of 4731 Da and molecular formula C221H342N46O68; measured purity and mass are only on that lot’s Certificate of Analysis you can verify before purchase. Ships same day on US orders placed before 2 PM EST, free over $150. For in-vitro laboratory research use only.
For laboratory research use only. Not for human or veterinary use.
Retatrutide (INN; development code LY3437943; catalog name GLP3-RETA) is an investigational synthetic 39-amino-acid fatty-acylated peptide, CAS 2381089-83-2, average molecular weight 4,731 Da. One backbone agonizes GIPR, GLP-1R, and GCGR. It is not FDA-approved and is not a medicine. On this page, ≥99% HPLC is the sourcing specification every accepted lot must meet — not a measurement of any one vial. The measured purity and mass for a lot are only on that lot’s Certificate of Analysis. For in-vitro laboratory research use only. Not for human or veterinary use.
Purity standard: Retatrutide is sourced to ≥99% HPLC — sourcing spec. See how to read a peptide COA.
1 · Select Size
10mg · $65.00/vial
Certificate of Analysis
Showing CoA for 10mg.
- Identity on CoA
- GLP3-RT 10mg
- HPLC (measured)
- 99.82%
- Sourcing spec (separate line)
- ≥99% by HPLC
- Lot
- PX81126
- Accession / CoA number
- 10954
- Lab
- Mistral Diagnostics
In-depth research overview, mechanism of action, and study applications.
Issued by an independent third-party laboratory; Peptide.Express does not test in-house. Results are reproduced as-is and confirm compound identity, purity, and the analytical methods used. For questions about specific results, contact support@peptide.express.
Retatrutide Specifications
| Compound | Retatrutide |
|---|---|
| CAS | 2381089-83-2 |
| Molecular formula | C221H342N46O68 |
| Molecular weight | 4,731 Da |
| Sequence | YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS (39 residues; Aib 2 and 20, alpha-Me-Leu 13, C20 diacid on Lys17, C-terminal amide) |
| Purity | ≥99% by HPLC |
| Form | Lyophilized powder |
| Storage (lyophilized) | -20°C, desiccated, protected from light |
| Storage (reconstituted) | 2–8°C, use within 14–28 days |
Reconstituting Retatrutide: step-by-step peptide reconstitution guide. Concentration maths: peptide reconstitution calculator.
Buying Retatrutide — Frequently Asked Questions
What purity standard does Peptide.Express use for retatrutide?
Where is the Certificate of Analysis for retatrutide?
What testing does retatrutide undergo before shipping?
How should retatrutide be stored before and after reconstitution?
When do research-peptide orders ship?
Is retatrutide FDA approved?
Retatrutide research reference
Research Compounds Related to Retatrutide
All products are sold for in-vitro laboratory research use only. Not intended for human consumption, clinical use, or veterinary use. Peptide.Express makes no medical claims. Consult the published literature for research application guidance.
What we can show you the numbers for
- 23 Certificates of Analysis published.Verify with the issuing laboratory: BPC-157 · CJC-1295 + Ipamorelin (No DAC) · Epithalon · GHK-Cu · HCG · HGH · Ipamorelin · Kisspeptin-10 · KLOW Blend · Melanotan II · Mitochondrial Fuel Stack · MOTS-c · NAD+ · PT-141 · Retatrutide · Semax · Semax Nasal Spray · Sermorelin · SS-31 · TB-500 · Tesamorelin · Tirzepatide · Wolverine Blend.
- Orders after 2 PM EST may be processed the next business day
- Free US shipping on orders over $150