Shop
QualityLab ResultsPartner
Log In

TB-500 Safety Data Sheet

Prepared in the 16-section format of the Globally Harmonized System of Classification and Labelling of Chemicals (GHS), as required by the OSHA Hazard Communication Standard (29 CFR 1910.1200).

Last Updated: Revision: 1.0Supplier: Peptide.Express

Substance Identity

CAS Number
77591-33-4
Molecular Formula
C212H350N56O78S
Molecular Weight
4963.4 Da
Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 aa)
Synonyms
Synthetic Thymosin beta-4
GHS Signal Word
Warning
Appearance
White to off-white lyophilized powder
Storage
Keep container tightly closed in a dry and well-ventilated place.
GHS hazard statements for TB-500
CodeHazard Statement
H315Causes skin irritation.
H319Causes serious eye irritation.
H335May cause respiratory irritation.

TB-500

Section 1: Identification of the substance/mixture and of the company/undertaking

1.1 Product Identifier

Product Name
TB-500
Synonyms
Synthetic Thymosin beta-4
CAS Number
77591-33-4
Molecular Formula
C212H350N56O78S
Molecular Weight
4963.4 Da

1.2 Relevant identified uses of the substance or mixture and uses advised against

Identified Uses
For Research Use Only — Not for Human Consumption.
Uses Advised Against
Not for human or animal therapeutic or diagnostic use.

1.3 Details of the supplier of the safety data sheet

Supplier
Peptide.Express
Website
https://peptide.express
Phone
Contact via website

1.4 Emergency telephone number

Emergency Phone
Contact local poison control center or emergency services.

Section 2: Hazards identification

2.1 Classification of the substance or mixture

Classification according to Regulation (EC) No 1272/2008 [GHS/CLP]:

  • Skin Irritation (Category 2), H315
  • Eye Irritation (Category 2A), H319
  • Specific Target Organ Toxicity - Single Exposure (Category 3), Respiratory System, H335

2.2 GHS Label elements, including precautionary statements

Hazard Pictograms
GHS07 (Exclamation Mark)
Signal Word
Warning

Hazard Statements

  • H315: Causes skin irritation.
  • H319: Causes serious eye irritation.
  • H335: May cause respiratory irritation.

Precautionary Statements

  • P261: Avoid breathing dust/fume/gas/mist/vapors/spray.
  • P264: Wash skin thoroughly after handling.
  • P271: Use only outdoors or in a well-ventilated area.
  • P280: Wear protective gloves/protective clothing/eye protection/face protection.
  • P302+P352: IF ON SKIN: Wash with plenty of soap and water.
  • P305+P351+P338: IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
  • P312: Call a POISON CENTER or doctor/physician if you feel unwell.
  • P321: Specific treatment (see supplemental first aid instructions on this label).
  • P332+P313: If skin irritation occurs: Get medical advice/attention.
  • P337+P313: If eye irritation persists: Get medical advice/attention.
  • P362: Take off contaminated clothing and wash before reuse.
  • P403+P233: Store in a well-ventilated place. Keep container tightly closed.
  • P405: Store locked up.
  • P501: Dispose of contents/container to an approved waste disposal plant.

2.3 Other hazards

None known.

Section 3: Composition/information on ingredients

3.1 Substances

Chemical Name
TB-500 (Synthetic Thymosin beta-4)
Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 aa)
CAS Number
77591-33-4
Molecular Formula
C212H350N56O78S
Molecular Weight
4963.4 Da
Concentration
>98%

Section 4: First aid measures

4.1 Description of first aid measures

General Advice
Consult a physician. Show this safety data sheet to the doctor in attendance.
If Inhaled
If breathed in, move person into fresh air. If not breathing, give artificial respiration. Consult a physician.
In Case of Skin Contact
Wash off with soap and plenty of water. Consult a physician.
In Case of Eye Contact
Rinse thoroughly with plenty of water for at least 15 minutes and consult a physician.
If Swallowed
Never give anything by mouth to an unconscious person. Rinse mouth with water. Consult a physician.

4.2 Most important symptoms and effects, both acute and delayed

The most important known symptoms and effects are described in the labeling (see section 2.2) and/or in section 11.

4.3 Indication of any immediate medical attention and special treatment needed

No data available.

Section 5: Firefighting measures

5.1 Extinguishing media

Suitable Extinguishing Media
Use water spray, alcohol-resistant foam, dry chemical or carbon dioxide.

5.2 Special hazards arising from the substance or mixture

Carbon oxides, Nitrogen oxides (NOx), Sulfur oxides.

5.3 Advice for firefighters

Wear self-contained breathing apparatus for firefighting if necessary.

5.4 Further information

No data available.

Section 6: Accidental release measures

6.1 Personal precautions, protective equipment and emergency procedures

Use personal protective equipment. Avoid dust formation. Avoid breathing vapors, mist or gas. Ensure adequate ventilation. Evacuate personnel to safe areas. Avoid breathing dust. For personal protection see section 8.

6.2 Environmental precautions

Do not let product enter drains.

6.3 Methods and materials for containment and cleaning up

Pick up and arrange disposal without creating dust. Sweep up and shovel. Keep in suitable, closed containers for disposal.

6.4 Reference to other sections

For disposal see section 13.

Section 7: Handling and storage

7.1 Precautions for safe handling

Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Provide appropriate exhaust ventilation at places where dust is formed. For precautions see section 2.2.

7.2 Conditions for safe storage, including any incompatibilities

Storage Conditions
Keep container tightly closed in a dry and well-ventilated place.
Recommended Storage Temperature
-20°C for long-term storage; 2-8°C for short-term.
Special Requirements
Protect from light and moisture. Store under inert gas. Moisture sensitive.

7.3 Specific end use(s)

Apart from the uses mentioned in section 1.2 no other specific uses are stipulated.

Section 8: Exposure controls/personal protection

8.1 Control parameters

Components with workplace control parameters
Contains no substances with occupational exposure limit values.

8.2 Exposure controls

Appropriate Engineering Controls
Handle in accordance with good industrial hygiene and safety practice. Wash hands before breaks and at the end of workday.
Personal Protective Equipment
Eye/Face Protection
Safety glasses with side-shields conforming to EN166. Use equipment for eye protection tested and approved under appropriate government standards such as NIOSH (US) or EN 166(EU).
Skin Protection
Handle with gloves. Gloves must be inspected prior to use. Use proper glove removal technique (without touching glove's outer surface) to avoid skin contact with this product. Dispose of contaminated gloves after use in accordance with applicable laws and good laboratory practices. Wash and dry hands.
Body Protection
Impervious clothing. The type of protective equipment must be selected according to the concentration and amount of the dangerous substance at the specific workplace.
Respiratory Protection
For nuisance exposures use type P95 (US) or type P1 (EU EN 143) particle respirator. For higher level protection use type OV/AG/P99 (US) or type ABEK-P2 (EU EN 143) respirator cartridges. Use respirators and components tested and approved under appropriate government standards such as NIOSH (US) or CEN (EU).
Control of Environmental Exposure
Do not let product enter drains.

Section 9: Physical and chemical properties

9.1 Information on basic physical and chemical properties

Appearance
White to off-white lyophilized powder
Odor
Odorless
Odor Threshold
No data available
pH
3.0-5.0 in solution
Melting Point/Freezing Point
Decomposes before melting
Initial Boiling Point and Boiling Range
No data available
Flash Point
No data available
Evaporation Rate
No data available
Flammability (solid, gas)
No data available
Upper/Lower Flammability or Explosive Limits
No data available
Vapor Pressure
No data available
Vapor Density
No data available
Relative Density
No data available
Water Solubility
Soluble in water, DMSO, dilute acetic acid
Partition Coefficient (n-octanol/water)
No data available
Auto-ignition Temperature
No data available
Decomposition Temperature
No data available
Viscosity
No data available
Explosive Properties
No data available
Oxidizing Properties
No data available

9.2 Other safety information

No data available.

Section 10: Stability and reactivity

10.1 Reactivity

No data available.

10.2 Chemical stability

Stable under recommended storage conditions.

10.3 Possibility of hazardous reactions

No data available.

10.4 Conditions to avoid

Light, moisture, and heat.

10.5 Incompatible materials

Strong oxidizing agents, strong acids, strong bases.

10.6 Hazardous decomposition products

Hazardous decomposition products formed under fire conditions: Carbon oxides, Nitrogen oxides (NOx), Sulfur oxides. Other decomposition products: No data available. In the event of fire: see section 5.

Section 11: Toxicological information

11.1 Information on toxicological effects

Acute Toxicity
No data available.
Skin Corrosion/Irritation
Causes skin irritation.
Serious Eye Damage/Eye Irritation
Causes serious eye irritation.
Respiratory or Skin Sensitization
No data available.
Germ Cell Mutagenicity
No data available.
Carcinogenicity
IARC: No component of this product present at levels greater than or equal to 0.1% is identified as probable, possible or confirmed human carcinogen by IARC.
Reproductive Toxicity
No data available.
Specific Target Organ Toxicity - Single Exposure
Inhalation - May cause respiratory irritation.
Specific Target Organ Toxicity - Repeated Exposure
No data available.
Aspiration Hazard
No data available.
Additional Information
RTECS: Not available. To the best of our knowledge, the chemical, physical, and toxicological properties have not been thoroughly investigated.

Section 12: Ecological information

12.1 Toxicity

No data available.

12.2 Persistence and degradability

No data available.

12.3 Bioaccumulative potential

No data available.

12.4 Mobility in soil

No data available.

12.5 Results of PBT and vPvB assessment

PBT/vPvB assessment not available as chemical safety assessment not required/not conducted.

12.6 Other adverse effects

No data available.

Section 13: Disposal considerations

13.1 Waste treatment methods

Product
Offer surplus and non-recyclable solutions to a licensed disposal company. Contact a licensed professional waste disposal service to dispose of this material. Dissolve or mix the material with a combustible solvent and burn in a chemical incinerator equipped with an afterburner and scrubber.
Contaminated Packaging
Dispose of as unused product.

Section 14: Transport information

14.1 UN number

ADR/RID: - | IMDG: - | IATA: -

14.2 UN proper shipping name

ADR/RID
Not dangerous goods
IMDG
Not dangerous goods
IATA
Not dangerous goods
Note
Not regulated for transport (non-hazardous goods).

14.3 Transport hazard class(es)

ADR/RID: - | IMDG: - | IATA: -

14.4 Packaging group

ADR/RID: - | IMDG: - | IATA: -

14.5 Environmental hazards

ADR/RID: no | IMDG Marine pollutant: no | IATA: no

14.6 Special precautions for user

No data available.

Section 15: Regulatory information

15.1 Safety, health and environmental regulations/legislation specific for the substance or mixture

This safety datasheet complies with the requirements of Regulation (EC) No. 1907/2006.

15.2 Chemical safety assessment

For this product a chemical safety assessment was not carried out.

Section 16: Other information

Full text of H-Statements referred to under sections 2 and 3

  • H315: Causes skin irritation.
  • H319: Causes serious eye irritation.
  • H335: May cause respiratory irritation.

Further information

Date of Preparation
August 11, 2026
Revision
1.0
Disclaimer
The above information is believed to be correct but does not purport to be all inclusive and shall be used only as a guide. The information in this document is based on the present state of our knowledge and is applicable to the product with regard to appropriate safety precautions. It does not represent any guarantee of the properties of the product. Peptide.Express and its Affiliates shall not be held liable for any damage resulting from handling or from contact with the above product. For Research Use Only — Not for Human Consumption.