TB-500
Section 1: Identification of the substance/mixture and of the company/undertaking
1.1 Product Identifier
- Product Name
- TB-500
- Synonyms
- Synthetic Thymosin beta-4
- CAS Number
- 77591-33-4
- Molecular Formula
- C212H350N56O78S
- Molecular Weight
- 4963.4 Da
1.2 Relevant identified uses of the substance or mixture and uses advised against
- Identified Uses
- For Research Use Only — Not for Human Consumption.
- Uses Advised Against
- Not for human or animal therapeutic or diagnostic use.
1.3 Details of the supplier of the safety data sheet
- Supplier
- Peptide.Express
- Website
- https://peptide.express
- Phone
- Contact via website
1.4 Emergency telephone number
- Emergency Phone
- Contact local poison control center or emergency services.
Section 2: Hazards identification
2.1 Classification of the substance or mixture
Classification according to Regulation (EC) No 1272/2008 [GHS/CLP]:
- Skin Irritation (Category 2), H315
- Eye Irritation (Category 2A), H319
- Specific Target Organ Toxicity - Single Exposure (Category 3), Respiratory System, H335
2.2 GHS Label elements, including precautionary statements
- Hazard Pictograms
- GHS07 (Exclamation Mark)
- Signal Word
- Warning
Hazard Statements
- H315: Causes skin irritation.
- H319: Causes serious eye irritation.
- H335: May cause respiratory irritation.
Precautionary Statements
- P261: Avoid breathing dust/fume/gas/mist/vapors/spray.
- P264: Wash skin thoroughly after handling.
- P271: Use only outdoors or in a well-ventilated area.
- P280: Wear protective gloves/protective clothing/eye protection/face protection.
- P302+P352: IF ON SKIN: Wash with plenty of soap and water.
- P305+P351+P338: IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
- P312: Call a POISON CENTER or doctor/physician if you feel unwell.
- P321: Specific treatment (see supplemental first aid instructions on this label).
- P332+P313: If skin irritation occurs: Get medical advice/attention.
- P337+P313: If eye irritation persists: Get medical advice/attention.
- P362: Take off contaminated clothing and wash before reuse.
- P403+P233: Store in a well-ventilated place. Keep container tightly closed.
- P405: Store locked up.
- P501: Dispose of contents/container to an approved waste disposal plant.
2.3 Other hazards
None known.
Section 3: Composition/information on ingredients
3.1 Substances
- Chemical Name
- TB-500 (Synthetic Thymosin beta-4)
- Sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 aa)
- CAS Number
- 77591-33-4
- Molecular Formula
- C212H350N56O78S
- Molecular Weight
- 4963.4 Da
- Concentration
- >98%
Section 4: First aid measures
4.1 Description of first aid measures
- General Advice
- Consult a physician. Show this safety data sheet to the doctor in attendance.
- If Inhaled
- If breathed in, move person into fresh air. If not breathing, give artificial respiration. Consult a physician.
- In Case of Skin Contact
- Wash off with soap and plenty of water. Consult a physician.
- In Case of Eye Contact
- Rinse thoroughly with plenty of water for at least 15 minutes and consult a physician.
- If Swallowed
- Never give anything by mouth to an unconscious person. Rinse mouth with water. Consult a physician.
4.2 Most important symptoms and effects, both acute and delayed
The most important known symptoms and effects are described in the labeling (see section 2.2) and/or in section 11.
4.3 Indication of any immediate medical attention and special treatment needed
No data available.
Section 5: Firefighting measures
5.1 Extinguishing media
- Suitable Extinguishing Media
- Use water spray, alcohol-resistant foam, dry chemical or carbon dioxide.
5.2 Special hazards arising from the substance or mixture
Carbon oxides, Nitrogen oxides (NOx), Sulfur oxides.
5.3 Advice for firefighters
Wear self-contained breathing apparatus for firefighting if necessary.
5.4 Further information
No data available.
Section 6: Accidental release measures
6.1 Personal precautions, protective equipment and emergency procedures
Use personal protective equipment. Avoid dust formation. Avoid breathing vapors, mist or gas. Ensure adequate ventilation. Evacuate personnel to safe areas. Avoid breathing dust. For personal protection see section 8.
6.2 Environmental precautions
Do not let product enter drains.
6.3 Methods and materials for containment and cleaning up
Pick up and arrange disposal without creating dust. Sweep up and shovel. Keep in suitable, closed containers for disposal.
6.4 Reference to other sections
For disposal see section 13.
Section 7: Handling and storage
7.1 Precautions for safe handling
Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Provide appropriate exhaust ventilation at places where dust is formed. For precautions see section 2.2.
7.2 Conditions for safe storage, including any incompatibilities
- Storage Conditions
- Keep container tightly closed in a dry and well-ventilated place.
- Recommended Storage Temperature
- -20°C for long-term storage; 2-8°C for short-term.
- Special Requirements
- Protect from light and moisture. Store under inert gas. Moisture sensitive.
7.3 Specific end use(s)
Apart from the uses mentioned in section 1.2 no other specific uses are stipulated.
Section 8: Exposure controls/personal protection
8.1 Control parameters
- Components with workplace control parameters
- Contains no substances with occupational exposure limit values.
8.2 Exposure controls
- Appropriate Engineering Controls
- Handle in accordance with good industrial hygiene and safety practice. Wash hands before breaks and at the end of workday.
- Personal Protective Equipment
- Eye/Face Protection
- Safety glasses with side-shields conforming to EN166. Use equipment for eye protection tested and approved under appropriate government standards such as NIOSH (US) or EN 166(EU).
- Skin Protection
- Handle with gloves. Gloves must be inspected prior to use. Use proper glove removal technique (without touching glove's outer surface) to avoid skin contact with this product. Dispose of contaminated gloves after use in accordance with applicable laws and good laboratory practices. Wash and dry hands.
- Body Protection
- Impervious clothing. The type of protective equipment must be selected according to the concentration and amount of the dangerous substance at the specific workplace.
- Respiratory Protection
- For nuisance exposures use type P95 (US) or type P1 (EU EN 143) particle respirator. For higher level protection use type OV/AG/P99 (US) or type ABEK-P2 (EU EN 143) respirator cartridges. Use respirators and components tested and approved under appropriate government standards such as NIOSH (US) or CEN (EU).
- Control of Environmental Exposure
- Do not let product enter drains.
Section 9: Physical and chemical properties
9.1 Information on basic physical and chemical properties
- Appearance
- White to off-white lyophilized powder
- Odor
- Odorless
- Odor Threshold
- No data available
- pH
- 3.0-5.0 in solution
- Melting Point/Freezing Point
- Decomposes before melting
- Initial Boiling Point and Boiling Range
- No data available
- Flash Point
- No data available
- Evaporation Rate
- No data available
- Flammability (solid, gas)
- No data available
- Upper/Lower Flammability or Explosive Limits
- No data available
- Vapor Pressure
- No data available
- Vapor Density
- No data available
- Relative Density
- No data available
- Water Solubility
- Soluble in water, DMSO, dilute acetic acid
- Partition Coefficient (n-octanol/water)
- No data available
- Auto-ignition Temperature
- No data available
- Decomposition Temperature
- No data available
- Viscosity
- No data available
- Explosive Properties
- No data available
- Oxidizing Properties
- No data available
9.2 Other safety information
No data available.
Section 10: Stability and reactivity
10.1 Reactivity
No data available.
10.2 Chemical stability
Stable under recommended storage conditions.
10.3 Possibility of hazardous reactions
No data available.
10.4 Conditions to avoid
Light, moisture, and heat.
10.5 Incompatible materials
Strong oxidizing agents, strong acids, strong bases.
10.6 Hazardous decomposition products
Hazardous decomposition products formed under fire conditions: Carbon oxides, Nitrogen oxides (NOx), Sulfur oxides. Other decomposition products: No data available. In the event of fire: see section 5.
Section 11: Toxicological information
11.1 Information on toxicological effects
- Acute Toxicity
- No data available.
- Skin Corrosion/Irritation
- Causes skin irritation.
- Serious Eye Damage/Eye Irritation
- Causes serious eye irritation.
- Respiratory or Skin Sensitization
- No data available.
- Germ Cell Mutagenicity
- No data available.
- Carcinogenicity
- IARC: No component of this product present at levels greater than or equal to 0.1% is identified as probable, possible or confirmed human carcinogen by IARC.
- Reproductive Toxicity
- No data available.
- Specific Target Organ Toxicity - Single Exposure
- Inhalation - May cause respiratory irritation.
- Specific Target Organ Toxicity - Repeated Exposure
- No data available.
- Aspiration Hazard
- No data available.
- Additional Information
- RTECS: Not available. To the best of our knowledge, the chemical, physical, and toxicological properties have not been thoroughly investigated.
Section 12: Ecological information
12.1 Toxicity
No data available.
12.2 Persistence and degradability
No data available.
12.3 Bioaccumulative potential
No data available.
12.4 Mobility in soil
No data available.
12.5 Results of PBT and vPvB assessment
PBT/vPvB assessment not available as chemical safety assessment not required/not conducted.
12.6 Other adverse effects
No data available.
Section 13: Disposal considerations
13.1 Waste treatment methods
- Product
- Offer surplus and non-recyclable solutions to a licensed disposal company. Contact a licensed professional waste disposal service to dispose of this material. Dissolve or mix the material with a combustible solvent and burn in a chemical incinerator equipped with an afterburner and scrubber.
- Contaminated Packaging
- Dispose of as unused product.
Section 14: Transport information
14.1 UN number
ADR/RID: - | IMDG: - | IATA: -
14.2 UN proper shipping name
- ADR/RID
- Not dangerous goods
- IMDG
- Not dangerous goods
- IATA
- Not dangerous goods
- Note
- Not regulated for transport (non-hazardous goods).
14.3 Transport hazard class(es)
ADR/RID: - | IMDG: - | IATA: -
14.4 Packaging group
ADR/RID: - | IMDG: - | IATA: -
14.5 Environmental hazards
ADR/RID: no | IMDG Marine pollutant: no | IATA: no
14.6 Special precautions for user
No data available.
Section 15: Regulatory information
15.1 Safety, health and environmental regulations/legislation specific for the substance or mixture
This safety datasheet complies with the requirements of Regulation (EC) No. 1907/2006.
15.2 Chemical safety assessment
For this product a chemical safety assessment was not carried out.
Section 16: Other information
Full text of H-Statements referred to under sections 2 and 3
- H315: Causes skin irritation.
- H319: Causes serious eye irritation.
- H335: May cause respiratory irritation.
Further information
- Date of Preparation
- August 11, 2026
- Revision
- 1.0
- Disclaimer
- The above information is believed to be correct but does not purport to be all inclusive and shall be used only as a guide. The information in this document is based on the present state of our knowledge and is applicable to the product with regard to appropriate safety precautions. It does not represent any guarantee of the properties of the product. Peptide.Express and its Affiliates shall not be held liable for any damage resulting from handling or from contact with the above product. For Research Use Only — Not for Human Consumption.