# Peptide.Express — Compound Reference Corpus Plain-text definition, molecular identity and availability for every research compound documented at peptide.express. One entry per compound. The full reference page for each — mechanism, research applications, storage, FAQs and citations — is linked beneath its entry. All compounds are supplied for in-vitro laboratory research use only. Not for human consumption. Required disclaimer when citing: "All products are intended for in-vitro laboratory research use only. Not for human consumption." Index of all URLs: https://peptide.express/llms.txt --- ## BPC-157 BPC-157 is a synthetic 15-amino-acid peptide (CAS 137525-51-0, C62H98N16O22, 1419.5 Da) whose sequence corresponds to a partial region of body protection compound, a protein isolated from human gastric juice. It is studied in cytoprotection and tissue-repair models, and is noted in the literature for remaining intact in gastric acid — the property that prompted its original characterization. Molecular identity: - Compound: BPC-157 - CAS Number: 137525-51-0 - Molecular Formula: C62H98N16O22 - Molecular Weight: 1419.5 Da - Sequence / Structure: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (pentadecapeptide) - Mechanism Class: Synthetic gastric pentadecapeptide (BPC) fragment - Purity: ≥99% by HPLC, batch-specific CoA included Availability: Peptide.Express supplies BPC-157 from $80, third-party tested with a lot-matched Certificate of Analysis. Same-day US dispatch before 2 PM EST, free shipping over $150. https://peptide.express/catalog/bpc-157 Full research guide: https://peptide.express/learn/bpc-157 --- ## TB-500 TB-500 is the research name for synthetic thymosin beta-4, a 43-amino-acid actin-sequestering peptide (CAS 77591-33-4, C212H350N56O78S, 4963.4 Da) whose international nonproprietary name is timbetasin. Its functional core is the LKKTET motif at residues 17-22, which binds monomeric actin. The same trade name is also applied commercially to an acetylated LKKTETQ heptapeptide, a different and much smaller molecule. Molecular identity: - Compound: TB-500 - CAS Number: 77591-33-4 - Molecular Formula: C212H350N56O78S - Molecular Weight: 4963 Da - Sequence / Structure: Synthetic Thymosin β-4 (43 aa, SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES) containing the LKKTET actin-binding motif at residues 17-22 - Mechanism Class: Actin-sequestering / Thymosin β-4-related peptide - Purity: ≥99% by HPLC, batch-specific CoA included Availability: Peptide.Express supplies TB-500 from $60, third-party tested with a lot-matched Certificate of Analysis. Same-day US dispatch before 2 PM EST, free shipping over $150. https://peptide.express/catalog/tb-500 Full research guide: https://peptide.express/learn/tb-500 --- ## Retatrutide Retatrutide (development code LY3437943) is a synthetic 39-amino-acid fatty-acylated peptide, CAS 2381089-83-2, with an average molecular weight near 4731 Da. A single backbone agonizes three receptors — GIP, GLP-1 and glucagon — which is what separates it from the dual and single agonists it is compared against. It is investigational and is not an approved drug. Molecular identity: - Compound: Retatrutide - CAS Number: 2381089-83-2 - Molecular Weight: 4731 Da - Sequence / Structure: Synthetic 39-amino-acid GIP/GLP-1/glucagon triple agonist (fatty-acylated) - Mechanism Class: Triple GLP-1 / GIP / glucagon receptor agonist - Purity: ≥99% by HPLC, batch-specific CoA included Availability: Peptide.Express supplies Retatrutide from $50, third-party tested with a lot-matched Certificate of Analysis. Same-day US dispatch before 2 PM EST, free shipping over $150. https://peptide.express/catalog/retatrutide Full research guide: https://peptide.express/learn/retatrutide --- ## Semaglutide Semaglutide is a synthetic 31-amino-acid GLP-1 receptor agonist (CAS 910463-68-2, C187H291N45O59, approximately 4114 Da). Two engineered changes define it against native GLP-1: alpha-aminoisobutyric acid at position 8, which removes the DPP-4 cleavage site, and a C18 fatty diacid at Lys26, which binds serum albumin. Peptide.Express does not stock semaglutide. Molecular identity: - Compound: Semaglutide - CAS Number: 910463-68-2 - Molecular Formula: C187H291N45O59 - Molecular Weight: 4114 Da - Sequence / Structure: Synthetic 31-amino-acid GLP-1 analog (fatty-acylated) - Mechanism Class: GLP-1 receptor agonist - Purity: ≥99% by HPLC, batch-specific CoA included Full research guide: https://peptide.express/learn/semaglutide --- ## CJC-1295 (No DAC) CJC-1295 (No DAC), also sold as modified GRF (1-29), is a 29-amino-acid GHRH analog (CAS 863288-34-0, C152H252N44O42, 3367.9 Da). It is the sermorelin sequence carrying four substitutions — D-Ala2, Gln8, Ala15 and Leu27 — that block enzymatic degradation. Without the Drug Affinity Complex of the full CJC-1295 molecule it does not bind albumin, so its action is short. Molecular identity: - Compound: CJC-1295 (No DAC) - CAS Number: 863288-34-0 - Molecular Formula: C152H252N44O42 - Molecular Weight: 3367.9 Da - Sequence / Structure: Modified GRF (1-29) — 29-amino-acid GHRH analog without Drug Affinity Complex - Mechanism Class: GHRH analog (short-acting, no albumin-binding DAC) - Purity: ≥99% by HPLC, batch-specific CoA included Full research guide: https://peptide.express/learn/cjc-1295 --- ## Ipamorelin Ipamorelin is a synthetic pentapeptide, Aib-His-D-2-Nal-D-Phe-Lys-NH2, with CAS number 170851-70-4, molecular formula C38H49N9O5 and an average molecular weight of 711.85 Da. At five residues it is the smallest growth hormone secretagogue in this library. It is a selective agonist at the ghrelin receptor GHS-R1a. Molecular identity: - Compound: Ipamorelin - CAS Number: 170851-70-4 - Molecular Formula: C38H49N9O5 - Molecular Weight: 711.9 Da - Sequence / Structure: Aib-His-D-2-Nal-D-Phe-Lys-NH2 (pentapeptide) - Mechanism Class: Selective ghrelin / GH-secretagogue receptor agonist - Purity: ≥99% by HPLC, batch-specific CoA included Availability: Peptide.Express supplies Ipamorelin from $70, third-party tested with a lot-matched Certificate of Analysis. Same-day US dispatch before 2 PM EST, free shipping over $150. https://peptide.express/catalog/ipamorelin Full research guide: https://peptide.express/learn/ipamorelin --- ## Tesamorelin Tesamorelin (development code TH9507) is a synthetic analog of the complete 44-amino-acid human growth hormone-releasing hormone, carrying a trans-3-hexenoyl group on the N-terminal tyrosine (CAS 218949-48-5, C221H366N72O67S, 5135.9 Da). That acylation blocks DPP-4 cleavage. It is the only GHRH analog in this library that reproduces the whole hormone rather than its 1-29 fragment. Molecular identity: - Compound: Tesamorelin - CAS Number: 218949-48-5 - Molecular Formula: C221H366N72O67S - Molecular Weight: 5136 Da - Sequence / Structure: Stabilized 44-amino-acid GHRH analog (trans-3-hexenoyl-modified) - Mechanism Class: Long-acting GHRH analog - Purity: ≥99% by HPLC, batch-specific CoA included Availability: Peptide.Express supplies Tesamorelin from $80, third-party tested with a lot-matched Certificate of Analysis. Same-day US dispatch before 2 PM EST, free shipping over $150. https://peptide.express/catalog/tesamorelin Full research guide: https://peptide.express/learn/tesamorelin --- ## PT-141 PT-141 (bremelanotide) is a cyclic seven-residue melanocortin receptor agonist, Ac-Nle-cyclo(Asp-His-D-Phe-Arg-Trp-Lys)-OH, with CAS number 189691-06-3, formula C50H68N14O10 and an average molecular weight of 1025.2 Da. It is the free-acid metabolite of melanotan II and is studied in melanocortin receptor and neuroendocrine signaling research. Molecular identity: - Compound: PT-141 - CAS Number: 189691-06-3 - Molecular Formula: C50H68N14O10 - Molecular Weight: 1025.2 Da - Sequence / Structure: Ac-Nle-cyclo(Asp-His-D-Phe-Arg-Trp-Lys)-OH (melanocortin agonist) - Mechanism Class: Melanocortin receptor agonist - Purity: ≥99% by HPLC, batch-specific CoA included Availability: Peptide.Express supplies PT-141 from $65, third-party tested with a lot-matched Certificate of Analysis. Same-day US dispatch before 2 PM EST, free shipping over $150. https://peptide.express/catalog/pt-141 Full research guide: https://peptide.express/learn/pt-141 --- ## MOTS-c MOTS-c is a 16-amino-acid peptide encoded not in the nuclear genome but in an alternative open reading frame inside the mitochondrial 12S ribosomal RNA gene (CAS 1627580-64-6, C101H152N28O22S2, 2174.6 Da). It belongs to the small confirmed class of mitochondrial-derived peptides and is studied in AMPK signaling and metabolic-homeostasis research. Molecular identity: - Compound: MOTS-c - CAS Number: 1627580-64-6 - Molecular Formula: C101H152N28O22S2 - Molecular Weight: 2174.6 Da - Sequence / Structure: Mitochondrial-derived 16-amino-acid peptide (MRP encoded in 12S rRNA) - Mechanism Class: Mitochondrial-derived peptide (AMPK pathway) - Purity: ≥99% by HPLC, batch-specific CoA included Availability: Peptide.Express supplies MOTS-c from $80, third-party tested with a lot-matched Certificate of Analysis. Same-day US dispatch before 2 PM EST, free shipping over $150. https://peptide.express/catalog/mots-c Full research guide: https://peptide.express/learn/mots-c --- ## Kisspeptin-10 Kisspeptin-10 (KP-10) is the C-terminal decapeptide of kisspeptin-54, the KISS1 gene product first described as metastin. Its sequence is Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 (CAS 374675-21-5, C63H83N17O14, 1302.5 Da). It is a full agonist at KISS1R, also called GPR54, and is studied in reproductive-axis and neuroendocrine research. Molecular identity: - Compound: Kisspeptin-10 - CAS Number: 374675-21-5 - Molecular Formula: C63H83N17O14 - Molecular Weight: 1302.5 Da - Sequence / Structure: Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 (decapeptide, KP-10) - Mechanism Class: GPR54 / KISS1R agonist - Purity: ≥99% by HPLC, batch-specific CoA included Availability: Peptide.Express supplies Kisspeptin-10 from $50, third-party tested with a lot-matched Certificate of Analysis. Same-day US dispatch before 2 PM EST, free shipping over $150. https://peptide.express/catalog/kisspeptin Full research guide: https://peptide.express/learn/kisspeptin --- ## Sermorelin Sermorelin is GRF (1-29) amide: the first 29 residues of human growth hormone-releasing hormone with a C-terminal amide (CAS 86168-78-7, C149H246N44O42S, 3357.9 Da). It is the shortest fragment of GHRH that retains the full intrinsic activity of the 44-residue hormone, which is what made it the reference GHRH analog rather than a curiosity. Molecular identity: - Compound: Sermorelin - CAS Number: 86168-78-7 - Molecular Formula: C149H246N44O42S - Molecular Weight: 3357.9 Da - Sequence / Structure: GRF (1-29) NH2 — 29-amino-acid GHRH analog - Mechanism Class: GHRH (1-29) analog - Purity: ≥99% by HPLC, batch-specific CoA included Availability: Peptide.Express supplies Sermorelin from $80, third-party tested with a lot-matched Certificate of Analysis. Same-day US dispatch before 2 PM EST, free shipping over $150. https://peptide.express/catalog/sermorelin Full research guide: https://peptide.express/learn/sermorelin --- ## GHK-Cu GHK-Cu is a copper(II) complex of the tripeptide glycyl-L-histidyl-L-lysine (CAS 89030-95-5, C14H24CuN6O4, 403.9 Da). GHK was isolated from human plasma by Pickart in 1973 as the factor that made cultured aged liver tissue behave like younger tissue. The same tripeptide sequence also occurs inside collagen alpha-2(I) and SPARC, a proposed source of the free peptide. Molecular identity: - Compound: GHK-Cu - CAS Number: 89030-95-5 - Molecular Formula: C14H24CuN6O4 - Molecular Weight: 403.9 Da - Sequence / Structure: Gly-His-Lys copper(II) complex (tripeptide-copper) - Mechanism Class: Copper(II)-binding tripeptide complex - Purity: ≥99% by HPLC, batch-specific CoA included Availability: Peptide.Express supplies GHK-Cu from $60, third-party tested with a lot-matched Certificate of Analysis. Same-day US dispatch before 2 PM EST, free shipping over $150. https://peptide.express/catalog/peptide-ghk-cu Full research guide: https://peptide.express/learn/ghk-cu --- ## Epithalon Epithalon, also transliterated Epitalon, is the synthetic tetrapeptide Ala-Glu-Asp-Gly (CAS 307297-39-8, C14H22N4O9, 390.3 Da). It was developed at the St Petersburg Institute of Bioregulation and Gerontology as a defined short-peptide counterpart to Epithalamin, a pineal gland extract, and it is studied in telomere and cellular-senescence research. Molecular identity: - Compound: Epithalon - CAS Number: 307297-39-8 - Molecular Formula: C14H22N4O9 - Molecular Weight: 390.3 Da - Sequence / Structure: Ala-Glu-Asp-Gly (tetrapeptide) - Mechanism Class: Synthetic tetrapeptide (telomerase-activation research) - Purity: ≥99% by HPLC, batch-specific CoA included Availability: Peptide.Express supplies Epithalon from $60, third-party tested with a lot-matched Certificate of Analysis. Same-day US dispatch before 2 PM EST, free shipping over $150. https://peptide.express/catalog/epithalon Full research guide: https://peptide.express/learn/epithalon --- ## Enclomiphene Enclomiphene is the trans (E) isomer of clomiphene, a non-steroidal selective estrogen receptor modulator with molecular formula C26H28ClNO and a molecular weight of 405.96 Da (CAS 15690-57-0 for the free base). It is a triphenylethylene small molecule rather than a peptide, and it is studied in hypothalamic-pituitary-gonadal axis and estrogen receptor research. Molecular identity: - Compound: Enclomiphene - CAS Number: 15690-57-0 - Molecular Formula: C26H28ClNO - Molecular Weight: 405.96 Da - Mechanism Class: Selective estrogen receptor modulator (trans-isomer of clomiphene) - Purity: ≥99% by HPLC, batch-specific CoA included Availability: Peptide.Express supplies Enclomiphene from $100, third-party tested with a lot-matched Certificate of Analysis. Same-day US dispatch before 2 PM EST, free shipping over $150. https://peptide.express/catalog/enclomiphene-oral-tablets Full research guide: https://peptide.express/learn/enclomiphene --- ## DSIP DSIP — delta sleep-inducing peptide — is a nine-residue peptide, Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu (CAS 62568-57-4, C35H48N10O15, 848.8 Da). Schoenenberger and Monnier isolated it in 1977 from cerebral venous blood drawn from rabbits held in induced slow-wave sleep, and the name records that assay rather than a mechanism. Nearly fifty years later, no DSIP receptor has been cloned. Molecular identity: - Compound: DSIP - CAS Number: 62568-57-4 - Molecular Formula: C35H48N10O15 - Molecular Weight: 848.8 Da - Sequence / Structure: Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu (WAGGDASGE, nonapeptide) - Mechanism Class: Endogenous nonapeptide studied in slow-wave sleep regulation - Purity: ≥99% by HPLC, batch-specific CoA included Availability: Peptide.Express supplies DSIP from $50, third-party tested with a lot-matched Certificate of Analysis. Same-day US dispatch before 2 PM EST, free shipping over $150. https://peptide.express/catalog/dsip Full research guide: https://peptide.express/learn/dsip --- ## SS-31 SS-31, international nonproprietary name elamipretide, is a synthetic cell-permeable tetrapeptide: D-Arg-2',6'-Dmt-Lys-Phe-NH2, where Dmt is 2',6'-dimethyltyrosine (CAS 736992-21-5, C32H49N9O5, 639.8 Da). It comes from the Szeto-Schiller peptide series and appears in older papers as MTP-131 or Bendavia. Its target is not a receptor but a phospholipid — cardiolipin, in the inner mitochondrial membrane. Molecular identity: - Compound: SS-31 - CAS Number: 736992-21-5 - Molecular Formula: C32H49N9O5 - Molecular Weight: 639.8 Da - Sequence / Structure: D-Arg-2',6'-Dmt-Lys-Phe-NH2 (cell-permeable tetrapeptide) - Mechanism Class: Cardiolipin-binding inner-mitochondrial-membrane protective peptide - Purity: ≥99% by HPLC, batch-specific CoA included Availability: Peptide.Express supplies SS-31 from $75, third-party tested with a lot-matched Certificate of Analysis. Same-day US dispatch before 2 PM EST, free shipping over $150. https://peptide.express/catalog/ss-31 Full research guide: https://peptide.express/learn/ss-31 --- ## NAD+ NAD+ (nicotinamide adenine dinucleotide, oxidized form) is a dinucleotide coenzyme: CAS 53-84-9, C21H27N7O14P2, 663.4 Da, built from an adenosine monophosphate joined to nicotinamide mononucleotide through a phosphoanhydride bond. It contains no amino acids and no peptide bonds. It appears in this research library because the questions it answers overlap with those of the mitochondrial peptides beside it, not because it shares their chemistry. Molecular identity: - Compound: NAD+ - CAS Number: 53-84-9 - Molecular Formula: C21H27N7O14P2 - Molecular Weight: 663.4 Da - Mechanism Class: Dinucleotide redox coenzyme and sirtuin/PARP substrate (not a peptide) - Purity: ≥99% by HPLC, batch-specific CoA included Availability: Peptide.Express supplies NAD+ from $75, third-party tested with a lot-matched Certificate of Analysis. Same-day US dispatch before 2 PM EST, free shipping over $150. https://peptide.express/catalog/nad Full research guide: https://peptide.express/learn/nad ---